Anti CAT pAb (ATL-HPA051282 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA051282-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $328.00
    
         
                            Gene Name: CAT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027187: 86%, ENSRNOG00000008364: 89%
Entrez Gene ID: 847
Uniprot ID: P04040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFE | 
| Gene Sequence | ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFE | 
| Gene ID - Mouse | ENSMUSG00000027187 | 
| Gene ID - Rat | ENSRNOG00000008364 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti CAT pAb (ATL-HPA051282 w/enhanced validation) | |
| Datasheet | Anti CAT pAb (ATL-HPA051282 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti CAT pAb (ATL-HPA051282 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti CAT pAb (ATL-HPA051282 w/enhanced validation) | |
| Datasheet | Anti CAT pAb (ATL-HPA051282 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti CAT pAb (ATL-HPA051282 w/enhanced validation) | 
| Citations for Anti CAT pAb (ATL-HPA051282 w/enhanced validation) – 1 Found | 
| Ma, Xi; Zhou, Lin; Zheng, Shusen. Transcriptome analysis revealed key prognostic genes and microRNAs in hepatocellular carcinoma. Peerj. 8( 32296612):e8930. PubMed |