Anti CAT pAb (ATL-HPA051282 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051282-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CAT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027187: 86%, ENSRNOG00000008364: 89%
Entrez Gene ID: 847
Uniprot ID: P04040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFE |
Gene Sequence | ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFE |
Gene ID - Mouse | ENSMUSG00000027187 |
Gene ID - Rat | ENSRNOG00000008364 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAT pAb (ATL-HPA051282 w/enhanced validation) | |
Datasheet | Anti CAT pAb (ATL-HPA051282 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAT pAb (ATL-HPA051282 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CAT pAb (ATL-HPA051282 w/enhanced validation) | |
Datasheet | Anti CAT pAb (ATL-HPA051282 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAT pAb (ATL-HPA051282 w/enhanced validation) |
Citations for Anti CAT pAb (ATL-HPA051282 w/enhanced validation) – 1 Found |
Ma, Xi; Zhou, Lin; Zheng, Shusen. Transcriptome analysis revealed key prognostic genes and microRNAs in hepatocellular carcinoma. Peerj. 8( 32296612):e8930. PubMed |