Anti CASZ1 pAb (ATL-HPA028222)

Atlas Antibodies

Catalog No.:
ATL-HPA028222-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: castor zinc finger 1
Gene Name: CASZ1
Alternative Gene Name: castor, cst, FLJ20321, SRG, ZNF693
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028977: 87%, ENSRNOG00000013474: 88%
Entrez Gene ID: 54897
Uniprot ID: Q86V15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAGEQLSWPAPSTKTEERVGKE
Gene Sequence STMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAGEQLSWPAPSTKTEERVGKE
Gene ID - Mouse ENSMUSG00000028977
Gene ID - Rat ENSRNOG00000013474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CASZ1 pAb (ATL-HPA028222)
Datasheet Anti CASZ1 pAb (ATL-HPA028222) Datasheet (External Link)
Vendor Page Anti CASZ1 pAb (ATL-HPA028222) at Atlas Antibodies

Documents & Links for Anti CASZ1 pAb (ATL-HPA028222)
Datasheet Anti CASZ1 pAb (ATL-HPA028222) Datasheet (External Link)
Vendor Page Anti CASZ1 pAb (ATL-HPA028222)