Anti CAST pAb (ATL-HPA075906)

Atlas Antibodies

Catalog No.:
ATL-HPA075906-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: calpastatin
Gene Name: CAST
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021585: 74%, ENSRNOG00000010286: 72%
Entrez Gene ID: 831
Uniprot ID: P20810
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSA
Gene Sequence DTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSA
Gene ID - Mouse ENSMUSG00000021585
Gene ID - Rat ENSRNOG00000010286
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAST pAb (ATL-HPA075906)
Datasheet Anti CAST pAb (ATL-HPA075906) Datasheet (External Link)
Vendor Page Anti CAST pAb (ATL-HPA075906) at Atlas Antibodies

Documents & Links for Anti CAST pAb (ATL-HPA075906)
Datasheet Anti CAST pAb (ATL-HPA075906) Datasheet (External Link)
Vendor Page Anti CAST pAb (ATL-HPA075906)