Anti CAST pAb (ATL-HPA036882)
Atlas Antibodies
- SKU:
- ATL-HPA036882-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CAST
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021585: 75%, ENSRNOG00000010286: 69%
Entrez Gene ID: 831
Uniprot ID: P20810
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKE |
Gene Sequence | GPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKE |
Gene ID - Mouse | ENSMUSG00000021585 |
Gene ID - Rat | ENSRNOG00000010286 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAST pAb (ATL-HPA036882) | |
Datasheet | Anti CAST pAb (ATL-HPA036882) Datasheet (External Link) |
Vendor Page | Anti CAST pAb (ATL-HPA036882) at Atlas Antibodies |
Documents & Links for Anti CAST pAb (ATL-HPA036882) | |
Datasheet | Anti CAST pAb (ATL-HPA036882) Datasheet (External Link) |
Vendor Page | Anti CAST pAb (ATL-HPA036882) |