Anti CASQ2 pAb (ATL-HPA055298 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA055298-25

Protein Description: calsequestrin 2 (cardiac muscle)
Gene Name: CASQ2
Alternative Gene Name: PDIB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027861: 84%, ENSRNOG00000016243: 84%
Entrez Gene ID: 845
Uniprot ID: O14958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLY
• Gene Sequence: LEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLY
• Gene ID - Mouse: ENSMUSG00000027861
• Gene ID - Rat: ENSRNOG00000016243
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.