Anti CASQ2 pAb (ATL-HPA055298 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055298-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calsequestrin 2 (cardiac muscle)
Gene Name: CASQ2
Alternative Gene Name: PDIB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027861: 84%, ENSRNOG00000016243: 84%
Entrez Gene ID: 845
Uniprot ID: O14958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLY
Gene Sequence LEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLY
Gene ID - Mouse ENSMUSG00000027861
Gene ID - Rat ENSRNOG00000016243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CASQ2 pAb (ATL-HPA055298 w/enhanced validation)
Datasheet Anti CASQ2 pAb (ATL-HPA055298 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CASQ2 pAb (ATL-HPA055298 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CASQ2 pAb (ATL-HPA055298 w/enhanced validation)
Datasheet Anti CASQ2 pAb (ATL-HPA055298 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CASQ2 pAb (ATL-HPA055298 w/enhanced validation)