Anti CASP8 pAb (ATL-HPA005688)

Atlas Antibodies

SKU: ATL-HPA005688-25

• 
• 

Protein Description: caspase 8, apoptosis-related cysteine peptidase
Gene Name: CASP8
Alternative Gene Name: Casp-8, FLICE, MACH, MCH5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026029: 55%, ENSRNOG00000012331: 52%
Entrez Gene ID: 841
Uniprot ID: Q14790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICC
• Gene Sequence: LGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICC
• Gene ID - Mouse: ENSMUSG00000026029
• Gene ID - Rat: ENSRNOG00000012331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CASP8 pAb (ATL-HPA005688) – 1 Found

Márquez-Jurado, Silvia; Díaz-Colunga, Juan; das Neves, Ricardo Pires; Martinez-Lorente, Antonio; Almazán, Fernando; Guantes, Raúl; Iborra, Francisco J. Mitochondrial levels determine variability in cell death by modulating apoptotic gene expression. Nature Communications. 2018;9(1):389.