Anti CASP5 pAb (ATL-HPA040937)

Atlas Antibodies

Catalog No.:
ATL-HPA040937-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: caspase 5, apoptosis-related cysteine peptidase
Gene Name: CASP5
Alternative Gene Name: ICE(rel)III
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040907: 23%, ENSRNOG00000058643: 23%
Entrez Gene ID: 838
Uniprot ID: P51878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV
Gene Sequence VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV
Gene ID - Mouse ENSMUSG00000040907
Gene ID - Rat ENSRNOG00000058643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CASP5 pAb (ATL-HPA040937)
Datasheet Anti CASP5 pAb (ATL-HPA040937) Datasheet (External Link)
Vendor Page Anti CASP5 pAb (ATL-HPA040937) at Atlas Antibodies

Documents & Links for Anti CASP5 pAb (ATL-HPA040937)
Datasheet Anti CASP5 pAb (ATL-HPA040937) Datasheet (External Link)
Vendor Page Anti CASP5 pAb (ATL-HPA040937)