Anti CASP5 pAb (ATL-HPA040937)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040937-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CASP5
Alternative Gene Name: ICE(rel)III
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040907: 23%, ENSRNOG00000058643: 23%
Entrez Gene ID: 838
Uniprot ID: P51878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV |
Gene Sequence | VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV |
Gene ID - Mouse | ENSMUSG00000040907 |
Gene ID - Rat | ENSRNOG00000058643 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CASP5 pAb (ATL-HPA040937) | |
Datasheet | Anti CASP5 pAb (ATL-HPA040937) Datasheet (External Link) |
Vendor Page | Anti CASP5 pAb (ATL-HPA040937) at Atlas Antibodies |
Documents & Links for Anti CASP5 pAb (ATL-HPA040937) | |
Datasheet | Anti CASP5 pAb (ATL-HPA040937) Datasheet (External Link) |
Vendor Page | Anti CASP5 pAb (ATL-HPA040937) |