Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002643-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CASP3
Alternative Gene Name: apopain, CPP32, CPP32B, Yama
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031628: 84%, ENSRNOG00000010475: 88%
Entrez Gene ID: 836
Uniprot ID: P42574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL |
| Gene Sequence | HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL |
| Gene ID - Mouse | ENSMUSG00000031628 |
| Gene ID - Rat | ENSRNOG00000010475 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) | |
| Datasheet | Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) | |
| Datasheet | Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) |
| Citations for Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) – 8 Found |
| Flanagan, L; Meyer, M; Fay, J; Curry, S; Bacon, O; Duessmann, H; John, K; Boland, K C; McNamara, D A; Kay, E W; Bantel, H; Schulze-Bergkamen, H; Prehn, J H M. Low levels of Caspase-3 predict favourable response to 5FU-based chemotherapy in advanced colorectal cancer: Caspase-3 inhibition as a therapeutic approach. Cell Death & Disease. 2016;7(2):e2087. PubMed |
| Wang, Jingwei; Ma, Aihua; Xi, Jiashui; Wang, Yulin; Zhao, Bojun. Connexin 43 and Its Hemichannels Mediate Hypoxia-Ischemia-Induced Cell Death in Neonatal Rats. Child Neurology Open. 2014;1(1):2329048X14544955. PubMed |
| Libé-Philippot, Baptiste; Michel, Vincent; Boutet de Monvel, Jacques; Le Gal, Sébastien; Dupont, Typhaine; Avan, Paul; Métin, Christine; Michalski, Nicolas; Petit, Christine. Auditory cortex interneuron development requires cadherins operating hair-cell mechanoelectrical transduction. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(30):7765-7774. PubMed |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Contín, Maria Ana; Arietti, Milagros M; Benedetto, María M; Bussi, Claudio; Guido, Mario E. Photoreceptor damage induced by low-intensity light: model of retinal degeneration in mammals. Molecular Vision. 19( 23901245):1614-25. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Tjandra, Irwan; Soeharso, Purnomo; Artini, Widya; Siregar, Nurjati Chairani; Victor, Andi Arus. Ganglion cells apoptosis in diabetic rats as early prediction of glaucoma: a study of Brn3b gene expression and association with change of quantity of NO, caspase-3, NF-κB, and TNF-α. International Journal Of Ophthalmology. 13(12):1872-1879. PubMed |
| Niewold, Timothy B; Meves, Alexander; Lehman, Julia S; Popovic-Silwerfeldt, Karin; Häyry, Aliisa; Söderlund-Matell, Therese; Charlesworth, Cristine M; Madden, Benjamin; Lundberg, Ingrid E; Wahren-Herlenius, Marie; Svenungsson, Elisabet; Oke, Vilija. Proteome study of cutaneous lupus erythematosus (CLE) and dermatomyositis skin lesions reveals IL-16 is differentially upregulated in CLE. Arthritis Research & Therapy. 2021;23(1):132. PubMed |