Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002643-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: caspase 3, apoptosis-related cysteine peptidase
Gene Name: CASP3
Alternative Gene Name: apopain, CPP32, CPP32B, Yama
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031628: 84%, ENSRNOG00000010475: 88%
Entrez Gene ID: 836
Uniprot ID: P42574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL
Gene Sequence HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL
Gene ID - Mouse ENSMUSG00000031628
Gene ID - Rat ENSRNOG00000010475
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation)
Datasheet Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation)
Datasheet Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation)
Citations for Anti CASP3 pAb (ATL-HPA002643 w/enhanced validation) – 8 Found
Flanagan, L; Meyer, M; Fay, J; Curry, S; Bacon, O; Duessmann, H; John, K; Boland, K C; McNamara, D A; Kay, E W; Bantel, H; Schulze-Bergkamen, H; Prehn, J H M. Low levels of Caspase-3 predict favourable response to 5FU-based chemotherapy in advanced colorectal cancer: Caspase-3 inhibition as a therapeutic approach. Cell Death & Disease. 2016;7(2):e2087.  PubMed
Wang, Jingwei; Ma, Aihua; Xi, Jiashui; Wang, Yulin; Zhao, Bojun. Connexin 43 and Its Hemichannels Mediate Hypoxia-Ischemia-Induced Cell Death in Neonatal Rats. Child Neurology Open. 2014;1(1):2329048X14544955.  PubMed
Libé-Philippot, Baptiste; Michel, Vincent; Boutet de Monvel, Jacques; Le Gal, Sébastien; Dupont, Typhaine; Avan, Paul; Métin, Christine; Michalski, Nicolas; Petit, Christine. Auditory cortex interneuron development requires cadherins operating hair-cell mechanoelectrical transduction. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(30):7765-7774.  PubMed
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300.  PubMed
Contín, Maria Ana; Arietti, Milagros M; Benedetto, María M; Bussi, Claudio; Guido, Mario E. Photoreceptor damage induced by low-intensity light: model of retinal degeneration in mammals. Molecular Vision. 19( 23901245):1614-25.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Tjandra, Irwan; Soeharso, Purnomo; Artini, Widya; Siregar, Nurjati Chairani; Victor, Andi Arus. Ganglion cells apoptosis in diabetic rats as early prediction of glaucoma: a study of Brn3b gene expression and association with change of quantity of NO, caspase-3, NF-κB, and TNF-α. International Journal Of Ophthalmology. 13(12):1872-1879.  PubMed
Niewold, Timothy B; Meves, Alexander; Lehman, Julia S; Popovic-Silwerfeldt, Karin; Häyry, Aliisa; Söderlund-Matell, Therese; Charlesworth, Cristine M; Madden, Benjamin; Lundberg, Ingrid E; Wahren-Herlenius, Marie; Svenungsson, Elisabet; Oke, Vilija. Proteome study of cutaneous lupus erythematosus (CLE) and dermatomyositis skin lesions reveals IL-16 is differentially upregulated in CLE. Arthritis Research & Therapy. 2021;23(1):132.  PubMed