Anti CASP1 pAb (ATL-HPA003056)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003056-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CASP1
Alternative Gene Name: ICE, IL1BC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025888: 72%, ENSRNOG00000007372: 75%
Entrez Gene ID: 834
Uniprot ID: P29466
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH |
| Gene Sequence | PDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH |
| Gene ID - Mouse | ENSMUSG00000025888 |
| Gene ID - Rat | ENSRNOG00000007372 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CASP1 pAb (ATL-HPA003056) | |
| Datasheet | Anti CASP1 pAb (ATL-HPA003056) Datasheet (External Link) |
| Vendor Page | Anti CASP1 pAb (ATL-HPA003056) at Atlas Antibodies |
| Documents & Links for Anti CASP1 pAb (ATL-HPA003056) | |
| Datasheet | Anti CASP1 pAb (ATL-HPA003056) Datasheet (External Link) |
| Vendor Page | Anti CASP1 pAb (ATL-HPA003056) |
| Citations for Anti CASP1 pAb (ATL-HPA003056) – 4 Found |
| Farshchian, Mehdi; Nissinen, Liisa; Siljamäki, Elina; Riihilä, Pilvi; Piipponen, Minna; Kivisaari, Atte; Kallajoki, Markku; Grénman, Reidar; Peltonen, Juha; Peltonen, Sirkku; Quint, Koen D; Bavinck, Jan Nico Bouwes; Kähäri, Veli-Matti. Tumor cell-specific AIM2 regulates growth and invasion of cutaneous squamous cell carcinoma. Oncotarget. 2017;8(28):45825-45836. PubMed |
| Guo, Tian; Liu, Tianyang; Sun, Yun; Liu, Xianna; Xiong, Rongguo; Li, He; Li, Zhitao; Zhang, Zhiguo; Tian, Zhen; Tian, Ye. Sonodynamic therapy inhibits palmitate-induced beta cell dysfunction via PINK1/Parkin-dependent mitophagy. Cell Death & Disease. 2019;10(6):457. PubMed |
| Yang, Li; Mizuochi, Tatsuki; Shivakumar, Pranavkumar; Mourya, Reena; Luo, Zhenhua; Gutta, Sridevi; Bezerra, Jorge A. Regulation of epithelial injury and bile duct obstruction by NLRP3, IL-1R1 in experimental biliary atresia. Journal Of Hepatology. 2018;69(5):1136-1144. PubMed |
| Liu, Fei; Fu, Jianxin; Bergstrom, Kirk; Shan, Xindi; McDaniel, J Michael; McGee, Samuel; Bai, Xia; Chen, Weichang; Xia, Lijun. Core 1-derived mucin-type O-glycosylation protects against spontaneous gastritis and gastric cancer. The Journal Of Experimental Medicine. 2020;217(1) PubMed |