Anti CASD1 pAb (ATL-HPA044404)

Atlas Antibodies

Catalog No.: ATL-HPA044404-25

Protein Description: CAS1 domain containing 1
Gene Name: CASD1
Alternative Gene Name: C7orf12, FLJ21213, FLJ21879
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015189: 95%, ENSRNOG00000047453: 95%
Entrez Gene ID: 64921
Uniprot ID: Q96PB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNEKIDAY
• Gene Sequence: SIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNEKIDAY
• Gene ID - Mouse: ENSMUSG00000015189
• Gene ID - Rat: ENSRNOG00000047453
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.