Anti CASD1 pAb (ATL-HPA044404)

Atlas Antibodies

Catalog No.:
ATL-HPA044404-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CAS1 domain containing 1
Gene Name: CASD1
Alternative Gene Name: C7orf12, FLJ21213, FLJ21879
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015189: 95%, ENSRNOG00000047453: 95%
Entrez Gene ID: 64921
Uniprot ID: Q96PB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNEKIDAY
Gene Sequence SIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNEKIDAY
Gene ID - Mouse ENSMUSG00000015189
Gene ID - Rat ENSRNOG00000047453
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CASD1 pAb (ATL-HPA044404)
Datasheet Anti CASD1 pAb (ATL-HPA044404) Datasheet (External Link)
Vendor Page Anti CASD1 pAb (ATL-HPA044404) at Atlas Antibodies

Documents & Links for Anti CASD1 pAb (ATL-HPA044404)
Datasheet Anti CASD1 pAb (ATL-HPA044404) Datasheet (External Link)
Vendor Page Anti CASD1 pAb (ATL-HPA044404)