Anti CASC4 pAb (ATL-HPA043015 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA043015-25
  • Immunohistochemical staining of human cerebral cortex, liver, lymph node and pancreas using Anti-CASC4 antibody HPA043015 (A) shows similar protein distribution across tissues to independent antibody HPA049488 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cancer susceptibility candidate 4
Gene Name: CASC4
Alternative Gene Name: DKFZp459F1927, H63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060227: 82%, ENSRNOG00000016357: 82%
Entrez Gene ID: 113201
Uniprot ID: Q6P4E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNE
Gene Sequence NTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNE
Gene ID - Mouse ENSMUSG00000060227
Gene ID - Rat ENSRNOG00000016357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CASC4 pAb (ATL-HPA043015 w/enhanced validation)
Datasheet Anti CASC4 pAb (ATL-HPA043015 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CASC4 pAb (ATL-HPA043015 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CASC4 pAb (ATL-HPA043015 w/enhanced validation)
Datasheet Anti CASC4 pAb (ATL-HPA043015 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CASC4 pAb (ATL-HPA043015 w/enhanced validation)