Anti CASC3 pAb (ATL-HPA024592)
Atlas Antibodies
- SKU:
- ATL-HPA024592-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CASC3
Alternative Gene Name: BTZ, MLN51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078676: 80%, ENSRNOG00000009716: 81%
Entrez Gene ID: 22794
Uniprot ID: O15234
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLN |
| Gene Sequence | DAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLN |
| Gene ID - Mouse | ENSMUSG00000078676 |
| Gene ID - Rat | ENSRNOG00000009716 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CASC3 pAb (ATL-HPA024592) | |
| Datasheet | Anti CASC3 pAb (ATL-HPA024592) Datasheet (External Link) |
| Vendor Page | Anti CASC3 pAb (ATL-HPA024592) at Atlas Antibodies |
| Documents & Links for Anti CASC3 pAb (ATL-HPA024592) | |
| Datasheet | Anti CASC3 pAb (ATL-HPA024592) Datasheet (External Link) |
| Vendor Page | Anti CASC3 pAb (ATL-HPA024592) |
| Citations for Anti CASC3 pAb (ATL-HPA024592) – 1 Found |
| Gerbracht, Jennifer V; Boehm, Volker; Britto-Borges, Thiago; Kallabis, Sebastian; Wiederstein, Janica L; Ciriello, Simona; Aschemeier, Dominik U; Krüger, Marcus; Frese, Christian K; Altmüller, Janine; Dieterich, Christoph; Gehring, Niels H. CASC3 promotes transcriptome-wide activation of nonsense-mediated decay by the exon junction complex. Nucleic Acids Research. 2020;48(15):8626-8644. PubMed |