Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046278-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: CARTPT
Alternative Gene Name: CART
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021647: 84%, ENSRNOG00000017712: 84%
Entrez Gene ID: 9607
Uniprot ID: Q16568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF |
| Gene Sequence | PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF |
| Gene ID - Mouse | ENSMUSG00000021647 |
| Gene ID - Rat | ENSRNOG00000017712 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation) | |
| Datasheet | Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation) | |
| Datasheet | Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation) |
| Citations for Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation) – 1 Found |
| D'Souza, Shane P; Swygart, David I; Wienbar, Sophia R; Upton, Brian A; Zhang, Kevin X; Mackin, Robert D; Casasent, Anna K; Samuel, Melanie A; Schwartz, Gregory W; Lang, Richard A. Retinal patterns and the cellular repertoire of neuropsin (Opn5) retinal ganglion cells. The Journal Of Comparative Neurology. 2022;530(8):1247-1262. PubMed |