Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA046278-100

Protein Description: CART prepropeptide
Gene Name: CARTPT
Alternative Gene Name: CART
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021647: 84%, ENSRNOG00000017712: 84%
Entrez Gene ID: 9607
Uniprot ID: Q16568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF
• Gene Sequence: PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF
• Gene ID - Mouse: ENSMUSG00000021647
• Gene ID - Rat: ENSRNOG00000017712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CARTPT pAb (ATL-HPA046278 w/enhanced validation) – 1 Found

D'Souza, Shane P; Swygart, David I; Wienbar, Sophia R; Upton, Brian A; Zhang, Kevin X; Mackin, Robert D; Casasent, Anna K; Samuel, Melanie A; Schwartz, Gregory W; Lang, Richard A. Retinal patterns and the cellular repertoire of neuropsin (Opn5) retinal ganglion cells. The Journal Of Comparative Neurology. 2022;530(8):1247-1262.