Anti CARS2 pAb (ATL-HPA041776)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041776-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CARS2
Alternative Gene Name: FLJ12118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056228: 75%, ENSRNOG00000014526: 73%
Entrez Gene ID: 79587
Uniprot ID: Q9HA77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR |
Gene Sequence | VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR |
Gene ID - Mouse | ENSMUSG00000056228 |
Gene ID - Rat | ENSRNOG00000014526 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CARS2 pAb (ATL-HPA041776) | |
Datasheet | Anti CARS2 pAb (ATL-HPA041776) Datasheet (External Link) |
Vendor Page | Anti CARS2 pAb (ATL-HPA041776) at Atlas Antibodies |
Documents & Links for Anti CARS2 pAb (ATL-HPA041776) | |
Datasheet | Anti CARS2 pAb (ATL-HPA041776) Datasheet (External Link) |
Vendor Page | Anti CARS2 pAb (ATL-HPA041776) |
Citations for Anti CARS2 pAb (ATL-HPA041776) – 1 Found |
Ichinoseki-Sekine, Noriko; Smuder, Ashley J; Morton, Aaron B; Hinkley, James M; Mor Huertas, Andres; Powers, Scott K. Hydrogen sulfide donor protects against mechanical ventilation-induced atrophy and contractile dysfunction in the rat diaphragm. Clinical And Translational Science. 2021;14(6):2139-2145. PubMed |