Anti CARS2 pAb (ATL-HPA041776)

Atlas Antibodies

SKU: ATL-HPA041776-25

• 
• 
• 

Protein Description: cysteinyl-tRNA synthetase 2, mitochondrial (putative)
Gene Name: CARS2
Alternative Gene Name: FLJ12118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056228: 75%, ENSRNOG00000014526: 73%
Entrez Gene ID: 79587
Uniprot ID: Q9HA77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR
• Gene Sequence: VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR
• Gene ID - Mouse: ENSMUSG00000056228
• Gene ID - Rat: ENSRNOG00000014526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CARS2 pAb (ATL-HPA041776) – 1 Found

Ichinoseki-Sekine, Noriko; Smuder, Ashley J; Morton, Aaron B; Hinkley, James M; Mor Huertas, Andres; Powers, Scott K. Hydrogen sulfide donor protects against mechanical ventilation-induced atrophy and contractile dysfunction in the rat diaphragm. Clinical And Translational Science. 2021;14(6):2139-2145.