Anti CARS2 pAb (ATL-HPA041776)

Atlas Antibodies

Catalog No.:
ATL-HPA041776-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cysteinyl-tRNA synthetase 2, mitochondrial (putative)
Gene Name: CARS2
Alternative Gene Name: FLJ12118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056228: 75%, ENSRNOG00000014526: 73%
Entrez Gene ID: 79587
Uniprot ID: Q9HA77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR
Gene Sequence VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR
Gene ID - Mouse ENSMUSG00000056228
Gene ID - Rat ENSRNOG00000014526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CARS2 pAb (ATL-HPA041776)
Datasheet Anti CARS2 pAb (ATL-HPA041776) Datasheet (External Link)
Vendor Page Anti CARS2 pAb (ATL-HPA041776) at Atlas Antibodies

Documents & Links for Anti CARS2 pAb (ATL-HPA041776)
Datasheet Anti CARS2 pAb (ATL-HPA041776) Datasheet (External Link)
Vendor Page Anti CARS2 pAb (ATL-HPA041776)
Citations for Anti CARS2 pAb (ATL-HPA041776) – 1 Found
Ichinoseki-Sekine, Noriko; Smuder, Ashley J; Morton, Aaron B; Hinkley, James M; Mor Huertas, Andres; Powers, Scott K. Hydrogen sulfide donor protects against mechanical ventilation-induced atrophy and contractile dysfunction in the rat diaphragm. Clinical And Translational Science. 2021;14(6):2139-2145.  PubMed