Anti CARS pAb (ATL-HPA002384 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002384-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cysteinyl-tRNA synthetase
Gene Name: CARS
Alternative Gene Name: CARS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010755: 79%, ENSRNOG00000020651: 79%
Entrez Gene ID: 833
Uniprot ID: P49589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL
Gene Sequence HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL
Gene ID - Mouse ENSMUSG00000010755
Gene ID - Rat ENSRNOG00000020651
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CARS pAb (ATL-HPA002384 w/enhanced validation)
Datasheet Anti CARS pAb (ATL-HPA002384 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CARS pAb (ATL-HPA002384 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CARS pAb (ATL-HPA002384 w/enhanced validation)
Datasheet Anti CARS pAb (ATL-HPA002384 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CARS pAb (ATL-HPA002384 w/enhanced validation)
Citations for Anti CARS pAb (ATL-HPA002384 w/enhanced validation) – 2 Found
Wang, Song; Chen, Shiming; Ying, Yufan; Ma, Xueyou; Shen, Haixiang; Li, Jiangfeng; Wang, Xiao; Lin, Yiwei; Liu, Ben; Zheng, Xiangyi; Xie, Liping. Comprehensive Analysis of Ferroptosis Regulators With Regard to PD-L1 and Immune Infiltration in Clear Cell Renal Cell Carcinoma. Frontiers In Cell And Developmental Biology. 9( 34291048):676142.  PubMed
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed