Anti CARS pAb (ATL-HPA002384 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002384-25

Protein Description: cysteinyl-tRNA synthetase
Gene Name: CARS
Alternative Gene Name: CARS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010755: 79%, ENSRNOG00000020651: 79%
Entrez Gene ID: 833
Uniprot ID: P49589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL
• Gene Sequence: HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL
• Gene ID - Mouse: ENSMUSG00000010755
• Gene ID - Rat: ENSRNOG00000020651
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CARS pAb (ATL-HPA002384 w/enhanced validation) – 2 Found

Wang, Song; Chen, Shiming; Ying, Yufan; Ma, Xueyou; Shen, Haixiang; Li, Jiangfeng; Wang, Xiao; Lin, Yiwei; Liu, Ben; Zheng, Xiangyi; Xie, Liping. Comprehensive Analysis of Ferroptosis Regulators With Regard to PD-L1 and Immune Infiltration in Clear Cell Renal Cell Carcinoma. Frontiers In Cell And Developmental Biology. 9( 34291048):676142. 

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.