Anti CARS pAb (ATL-HPA002384 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002384-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CARS
Alternative Gene Name: CARS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010755: 79%, ENSRNOG00000020651: 79%
Entrez Gene ID: 833
Uniprot ID: P49589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL |
| Gene Sequence | HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL |
| Gene ID - Mouse | ENSMUSG00000010755 |
| Gene ID - Rat | ENSRNOG00000020651 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CARS pAb (ATL-HPA002384 w/enhanced validation) | |
| Datasheet | Anti CARS pAb (ATL-HPA002384 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CARS pAb (ATL-HPA002384 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CARS pAb (ATL-HPA002384 w/enhanced validation) | |
| Datasheet | Anti CARS pAb (ATL-HPA002384 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CARS pAb (ATL-HPA002384 w/enhanced validation) |
| Citations for Anti CARS pAb (ATL-HPA002384 w/enhanced validation) – 2 Found |
| Wang, Song; Chen, Shiming; Ying, Yufan; Ma, Xueyou; Shen, Haixiang; Li, Jiangfeng; Wang, Xiao; Lin, Yiwei; Liu, Ben; Zheng, Xiangyi; Xie, Liping. Comprehensive Analysis of Ferroptosis Regulators With Regard to PD-L1 and Immune Infiltration in Clear Cell Renal Cell Carcinoma. Frontiers In Cell And Developmental Biology. 9( 34291048):676142. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |