Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038569-25

• 

Protein Description: carnosine synthase 1
Gene Name: CARNS1
Alternative Gene Name: ATPGD1, KIAA1394
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097064: 97%, ENSRNOG00000018603: 98%
Entrez Gene ID: 57571
Uniprot ID: A5YM72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LMEFVEGTEHDVDLVLFGGRLLAAFVSDNGPTRLPGFTETAACMPTGLAPEQEAQMVQAAFRCCLGCGLLDGVFNVELKLTGAGPRLIEINPRMGGFY
• Gene Sequence: LMEFVEGTEHDVDLVLFGGRLLAAFVSDNGPTRLPGFTETAACMPTGLAPEQEAQMVQAAFRCCLGCGLLDGVFNVELKLTGAGPRLIEINPRMGGFY
• Gene ID - Mouse: ENSMUSG00000097064
• Gene ID - Rat: ENSRNOG00000018603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation) – 1 Found

Zhang, Li; Zhang, Yan; Zhang, Xin; Li, Xinyu; He, Miao; Qiao, Shixing. Combining bioinformatics analysis and experiments to explore CARNS1 as a prognostic biomarker for breast cancer. Molecular Genetics & Genomic Medicine. 2021;9(2):e1586.