Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038569-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CARNS1
Alternative Gene Name: ATPGD1, KIAA1394
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097064: 97%, ENSRNOG00000018603: 98%
Entrez Gene ID: 57571
Uniprot ID: A5YM72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LMEFVEGTEHDVDLVLFGGRLLAAFVSDNGPTRLPGFTETAACMPTGLAPEQEAQMVQAAFRCCLGCGLLDGVFNVELKLTGAGPRLIEINPRMGGFY |
Gene Sequence | LMEFVEGTEHDVDLVLFGGRLLAAFVSDNGPTRLPGFTETAACMPTGLAPEQEAQMVQAAFRCCLGCGLLDGVFNVELKLTGAGPRLIEINPRMGGFY |
Gene ID - Mouse | ENSMUSG00000097064 |
Gene ID - Rat | ENSRNOG00000018603 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation) | |
Datasheet | Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation) | |
Datasheet | Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation) |
Citations for Anti CARNS1 pAb (ATL-HPA038569 w/enhanced validation) – 1 Found |
Zhang, Li; Zhang, Yan; Zhang, Xin; Li, Xinyu; He, Miao; Qiao, Shixing. Combining bioinformatics analysis and experiments to explore CARNS1 as a prognostic biomarker for breast cancer. Molecular Genetics & Genomic Medicine. 2021;9(2):e1586. PubMed |