Anti CARMIL2 pAb (ATL-HPA041402)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041402-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CARMIL2
Alternative Gene Name: LRRC16C, RLTPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050357: 91%, ENSRNOG00000024452: 92%
Entrez Gene ID: 146206
Uniprot ID: Q6F5E8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ |
Gene Sequence | EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ |
Gene ID - Mouse | ENSMUSG00000050357 |
Gene ID - Rat | ENSRNOG00000024452 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CARMIL2 pAb (ATL-HPA041402) | |
Datasheet | Anti CARMIL2 pAb (ATL-HPA041402) Datasheet (External Link) |
Vendor Page | Anti CARMIL2 pAb (ATL-HPA041402) at Atlas Antibodies |
Documents & Links for Anti CARMIL2 pAb (ATL-HPA041402) | |
Datasheet | Anti CARMIL2 pAb (ATL-HPA041402) Datasheet (External Link) |
Vendor Page | Anti CARMIL2 pAb (ATL-HPA041402) |
Citations for Anti CARMIL2 pAb (ATL-HPA041402) – 3 Found |
Schober, T; Magg, T; Laschinger, M; Rohlfs, M; Linhares, N D; Puchalka, J; Weisser, T; Fehlner, K; Mautner, J; Walz, C; Hussein, K; Jaeger, G; Kammer, B; Schmid, I; Bahia, M; Pena, S D; Behrends, U; Belohradsky, B H; Klein, C; Hauck, F. A human immunodeficiency syndrome caused by mutations in CARMIL2. Nature Communications. 2017;8( 28112205):14209. PubMed |
Magg, Thomas; Shcherbina, Anna; Arslan, Duran; Desai, Mukesh M; Wall, Sarah; Mitsialis, Vanessa; Conca, Raffaele; Unal, Ekrem; Karacabey, Neslihan; Mukhina, Anna; Rodina, Yulia; Taur, Prasad D; Illig, David; Marquardt, Benjamin; Hollizeck, Sebastian; Jeske, Tim; Gothe, Florian; Schober, Tilmann; Rohlfs, Meino; Koletzko, Sibylle; Lurz, Eberhard; Muise, Aleixo M; Snapper, Scott B; Hauck, Fabian; Klein, Christoph; Kotlarz, Daniel. CARMIL2 Deficiency Presenting as Very Early Onset Inflammatory Bowel Disease. Inflammatory Bowel Diseases. 2019;25(11):1788-1795. PubMed |
Bosa, Luca; Batura, Vritika; Colavito, Davide; Fiedler, Karoline; Gaio, Paola; Guo, Conghui; Li, Qi; Marzollo, Antonio; Mescoli, Claudia; Nambu, Ryusuke; Pan, Jie; Perilongo, Giorgio; Warner, Neil; Zhang, Shiqi; Kotlarz, Daniel; Klein, Christoph; Snapper, Scott B; Walters, Thomas D; Leon, Alberta; Griffiths, Anne M; Cananzi, Mara; Muise, Aleixo M. Novel CARMIL2 loss-of-function variants are associated with pediatric inflammatory bowel disease. Scientific Reports. 2021;11(1):5945. PubMed |