Anti CARMIL1 pAb (ATL-HPA029039 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029039-25
  • Immunohistochemical staining of human colon, kidney, lymph node and testis using Anti-CARMIL1 antibody HPA029039 (A) shows similar protein distribution across tissues to independent antibody HPA029038 (B).
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: capping protein regulator and myosin 1 linker 1
Gene Name: CARMIL1
Alternative Gene Name: CARMIL, dJ501N12.1, FLJ20048, LRRC16, LRRC16A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021338: 74%, ENSRNOG00000016576: 77%
Entrez Gene ID: 55604
Uniprot ID: Q5VZK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPALSSVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEA
Gene Sequence RSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPALSSVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEA
Gene ID - Mouse ENSMUSG00000021338
Gene ID - Rat ENSRNOG00000016576
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CARMIL1 pAb (ATL-HPA029039 w/enhanced validation)
Datasheet Anti CARMIL1 pAb (ATL-HPA029039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CARMIL1 pAb (ATL-HPA029039 w/enhanced validation)