Anti CARD8 pAb (ATL-HPA042071)

Atlas Antibodies

Catalog No.: ATL-HPA042071-25

Protein Description: caspase recruitment domain family, member 8
Gene Name: CARD8
Alternative Gene Name: CARDINAL, Dakar, KIAA0955, NDPP, TUCAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058328: 27%, ENSRNOG00000023143: 31%
Entrez Gene ID: 22900
Uniprot ID: Q9Y2G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA
• Gene Sequence: TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA
• Gene ID - Mouse: ENSMUSG00000058328
• Gene ID - Rat: ENSRNOG00000023143
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.