Anti CARD19 pAb (ATL-HPA010921)

Atlas Antibodies

Catalog No.:
ATL-HPA010921-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: caspase recruitment domain family, member 19
Gene Name: CARD19
Alternative Gene Name: bA370F5.1, BinCARD, C9orf89, MGC11115
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037960: 94%, ENSRNOG00000016560: 89%
Entrez Gene ID: 84270
Uniprot ID: Q96LW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLG
Gene Sequence PKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLG
Gene ID - Mouse ENSMUSG00000037960
Gene ID - Rat ENSRNOG00000016560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CARD19 pAb (ATL-HPA010921)
Datasheet Anti CARD19 pAb (ATL-HPA010921) Datasheet (External Link)
Vendor Page Anti CARD19 pAb (ATL-HPA010921) at Atlas Antibodies

Documents & Links for Anti CARD19 pAb (ATL-HPA010921)
Datasheet Anti CARD19 pAb (ATL-HPA010921) Datasheet (External Link)
Vendor Page Anti CARD19 pAb (ATL-HPA010921)