Anti CARD19 pAb (ATL-HPA010921)

Atlas Antibodies

Catalog No.: ATL-HPA010921-25

Protein Description: caspase recruitment domain family, member 19
Gene Name: CARD19
Alternative Gene Name: bA370F5.1, BinCARD, C9orf89, MGC11115
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037960: 94%, ENSRNOG00000016560: 89%
Entrez Gene ID: 84270
Uniprot ID: Q96LW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLG
• Gene Sequence: PKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLG
• Gene ID - Mouse: ENSMUSG00000037960
• Gene ID - Rat: ENSRNOG00000016560
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.