Anti CARD18 pAb (ATL-HPA038582)

Atlas Antibodies

Catalog No.:
ATL-HPA038582-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: caspase recruitment domain family, member 18
Gene Name: CARD18
Alternative Gene Name: ICEBERG, pseudo-ICE, UNQ5804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025888: 47%, ENSRNOG00000007372: 49%
Entrez Gene ID: 59082
Uniprot ID: P57730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Gene Sequence DTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Gene ID - Mouse ENSMUSG00000025888
Gene ID - Rat ENSRNOG00000007372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CARD18 pAb (ATL-HPA038582)
Datasheet Anti CARD18 pAb (ATL-HPA038582) Datasheet (External Link)
Vendor Page Anti CARD18 pAb (ATL-HPA038582) at Atlas Antibodies

Documents & Links for Anti CARD18 pAb (ATL-HPA038582)
Datasheet Anti CARD18 pAb (ATL-HPA038582) Datasheet (External Link)
Vendor Page Anti CARD18 pAb (ATL-HPA038582)