Anti CAPSL pAb (ATL-HPA058495 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058495-25
  • Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CAPSL antibody. Corresponding CAPSL RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & microtubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcyphosine-like
Gene Name: CAPSL
Alternative Gene Name: MGC26610
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039676: 96%, ENSRNOG00000054277: 96%
Entrez Gene ID: 133690
Uniprot ID: Q8WWF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQ
Gene Sequence PMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQ
Gene ID - Mouse ENSMUSG00000039676
Gene ID - Rat ENSRNOG00000054277
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAPSL pAb (ATL-HPA058495 w/enhanced validation)
Datasheet Anti CAPSL pAb (ATL-HPA058495 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPSL pAb (ATL-HPA058495 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAPSL pAb (ATL-HPA058495 w/enhanced validation)
Datasheet Anti CAPSL pAb (ATL-HPA058495 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPSL pAb (ATL-HPA058495 w/enhanced validation)