Anti CAPS2 pAb (ATL-HPA040004)

Atlas Antibodies

SKU:
ATL-HPA040004-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcyphosine 2
Gene Name: CAPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035694: 74%, ENSRNOG00000026600: 71%
Entrez Gene ID: 84698
Uniprot ID: Q9BXY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGII
Gene Sequence NDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGII
Gene ID - Mouse ENSMUSG00000035694
Gene ID - Rat ENSRNOG00000026600
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAPS2 pAb (ATL-HPA040004)
Datasheet Anti CAPS2 pAb (ATL-HPA040004) Datasheet (External Link)
Vendor Page Anti CAPS2 pAb (ATL-HPA040004) at Atlas Antibodies

Documents & Links for Anti CAPS2 pAb (ATL-HPA040004)
Datasheet Anti CAPS2 pAb (ATL-HPA040004) Datasheet (External Link)
Vendor Page Anti CAPS2 pAb (ATL-HPA040004)