Anti CAPS2 pAb (ATL-HPA040004)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040004-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CAPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035694: 74%, ENSRNOG00000026600: 71%
Entrez Gene ID: 84698
Uniprot ID: Q9BXY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGII |
| Gene Sequence | NDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGII |
| Gene ID - Mouse | ENSMUSG00000035694 |
| Gene ID - Rat | ENSRNOG00000026600 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAPS2 pAb (ATL-HPA040004) | |
| Datasheet | Anti CAPS2 pAb (ATL-HPA040004) Datasheet (External Link) |
| Vendor Page | Anti CAPS2 pAb (ATL-HPA040004) at Atlas Antibodies |
| Documents & Links for Anti CAPS2 pAb (ATL-HPA040004) | |
| Datasheet | Anti CAPS2 pAb (ATL-HPA040004) Datasheet (External Link) |
| Vendor Page | Anti CAPS2 pAb (ATL-HPA040004) |