Anti CAPS2 pAb (ATL-HPA040004)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040004-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CAPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035694: 74%, ENSRNOG00000026600: 71%
Entrez Gene ID: 84698
Uniprot ID: Q9BXY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGII |
Gene Sequence | NDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGII |
Gene ID - Mouse | ENSMUSG00000035694 |
Gene ID - Rat | ENSRNOG00000026600 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAPS2 pAb (ATL-HPA040004) | |
Datasheet | Anti CAPS2 pAb (ATL-HPA040004) Datasheet (External Link) |
Vendor Page | Anti CAPS2 pAb (ATL-HPA040004) at Atlas Antibodies |
Documents & Links for Anti CAPS2 pAb (ATL-HPA040004) | |
Datasheet | Anti CAPS2 pAb (ATL-HPA040004) Datasheet (External Link) |
Vendor Page | Anti CAPS2 pAb (ATL-HPA040004) |