Anti CAPS2 pAb (ATL-HPA039542)

Atlas Antibodies

Catalog No.:
ATL-HPA039542-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: calcyphosine 2
Gene Name: CAPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035694: 54%, ENSRNOG00000026600: 57%
Entrez Gene ID: 84698
Uniprot ID: Q9BXY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGSLVDSDDEDNFSYIPLSTANLPNSSSTLGWVTPCQTPYTQYHLNKLDQNIIPENLPAPTDKCKLKYQQCKTEIKEGYKQYSQRNAENTKSNVT
Gene Sequence LGSLVDSDDEDNFSYIPLSTANLPNSSSTLGWVTPCQTPYTQYHLNKLDQNIIPENLPAPTDKCKLKYQQCKTEIKEGYKQYSQRNAENTKSNVT
Gene ID - Mouse ENSMUSG00000035694
Gene ID - Rat ENSRNOG00000026600
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAPS2 pAb (ATL-HPA039542)
Datasheet Anti CAPS2 pAb (ATL-HPA039542) Datasheet (External Link)
Vendor Page Anti CAPS2 pAb (ATL-HPA039542) at Atlas Antibodies

Documents & Links for Anti CAPS2 pAb (ATL-HPA039542)
Datasheet Anti CAPS2 pAb (ATL-HPA039542) Datasheet (External Link)
Vendor Page Anti CAPS2 pAb (ATL-HPA039542)