Anti CAPS2 pAb (ATL-HPA039542)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039542-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $447.00
    
         
                            Gene Name: CAPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035694: 54%, ENSRNOG00000026600: 57%
Entrez Gene ID: 84698
Uniprot ID: Q9BXY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | LGSLVDSDDEDNFSYIPLSTANLPNSSSTLGWVTPCQTPYTQYHLNKLDQNIIPENLPAPTDKCKLKYQQCKTEIKEGYKQYSQRNAENTKSNVT | 
| Gene Sequence | LGSLVDSDDEDNFSYIPLSTANLPNSSSTLGWVTPCQTPYTQYHLNKLDQNIIPENLPAPTDKCKLKYQQCKTEIKEGYKQYSQRNAENTKSNVT | 
| Gene ID - Mouse | ENSMUSG00000035694 | 
| Gene ID - Rat | ENSRNOG00000026600 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti CAPS2 pAb (ATL-HPA039542) | |
| Datasheet | Anti CAPS2 pAb (ATL-HPA039542) Datasheet (External Link) | 
| Vendor Page | Anti CAPS2 pAb (ATL-HPA039542) at Atlas Antibodies | 
| Documents & Links for Anti CAPS2 pAb (ATL-HPA039542) | |
| Datasheet | Anti CAPS2 pAb (ATL-HPA039542) Datasheet (External Link) | 
| Vendor Page | Anti CAPS2 pAb (ATL-HPA039542) | 
 
         
                            