Anti CAPS pAb (ATL-HPA043520 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043520-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: calcyphosine
Gene Name: CAPS
Alternative Gene Name: CAPS1, MGC126562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039676: 52%, ENSRNOG00000054277: 52%
Entrez Gene ID: 828
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDL
Gene Sequence FRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDL
Gene ID - Mouse ENSMUSG00000039676
Gene ID - Rat ENSRNOG00000054277
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAPS pAb (ATL-HPA043520 w/enhanced validation)
Datasheet Anti CAPS pAb (ATL-HPA043520 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPS pAb (ATL-HPA043520 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAPS pAb (ATL-HPA043520 w/enhanced validation)
Datasheet Anti CAPS pAb (ATL-HPA043520 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPS pAb (ATL-HPA043520 w/enhanced validation)
Citations for Anti CAPS pAb (ATL-HPA043520 w/enhanced validation) – 2 Found
Zhu, Zheng; Wang, Jiao; Tan, Juan; Yao, Yue-Liang; He, Zhi-Cheng; Xie, Xiao-Qing; Yan, Ze-Xuan; Fu, Wen-Juan; Liu, Qing; Wang, Yan-Xia; Luo, Tao; Bian, Xiu-Wu. Calcyphosine promotes the proliferation of glioma cells and serves as a potential therapeutic target. The Journal Of Pathology. 2021;255(4):374-386.  PubMed
Richardson, Michael T; Recouvreux, Maria Sol; Karlan, Beth Y; Walts, Ann E; Orsulic, Sandra. Ciliated Cells in Ovarian Cancer Decrease with Increasing Tumor Grade and Disease Progression. Cells. 2022;11(24)  PubMed