Anti CAPRIN2 pAb (ATL-HPA039746)

Atlas Antibodies

SKU:
ATL-HPA039746-25
  • Immunohistochemical staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & centrosome.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: caprin family member 2
Gene Name: CAPRIN2
Alternative Gene Name: C1QDC1, caprin-2, EEG1, FLJ11391, FLJ22569, RNG140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030309: 75%, ENSRNOG00000047319: 74%
Entrez Gene ID: 65981
Uniprot ID: Q6IMN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPKPRENNVESQKHSLTSQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVHQPVGSSSTLPKDPVLRKEKLQDLMTQIQGT
Gene Sequence TPKPRENNVESQKHSLTSQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVHQPVGSSSTLPKDPVLRKEKLQDLMTQIQGT
Gene ID - Mouse ENSMUSG00000030309
Gene ID - Rat ENSRNOG00000047319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAPRIN2 pAb (ATL-HPA039746)
Datasheet Anti CAPRIN2 pAb (ATL-HPA039746) Datasheet (External Link)
Vendor Page Anti CAPRIN2 pAb (ATL-HPA039746) at Atlas Antibodies

Documents & Links for Anti CAPRIN2 pAb (ATL-HPA039746)
Datasheet Anti CAPRIN2 pAb (ATL-HPA039746) Datasheet (External Link)
Vendor Page Anti CAPRIN2 pAb (ATL-HPA039746)