Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA063617-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cell cycle associated protein 1
Gene Name: CAPRIN1
Alternative Gene Name: caprin-1, GPIAP1, M11S1, RNG105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027184: 97%, ENSRNOG00000009152: 97%
Entrez Gene ID: 4076
Uniprot ID: Q14444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM
Gene Sequence TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM
Gene ID - Mouse ENSMUSG00000027184
Gene ID - Rat ENSRNOG00000009152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation)
Datasheet Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation)
Datasheet Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPRIN1 pAb (ATL-HPA063617 w/enhanced validation)