Anti CAPNS2 pAb (ATL-HPA059749)

Atlas Antibodies

Catalog No.: ATL-HPA059749-25

Protein Description: calpain small subunit 2
Gene Name: CAPNS2
Alternative Gene Name: MGC12536, MGC14804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078144: 86%, ENSRNOG00000045747: 55%
Entrez Gene ID: 84290
Uniprot ID: Q96L46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
• Gene Sequence: KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
• Gene ID - Mouse: ENSMUSG00000078144
• Gene ID - Rat: ENSRNOG00000045747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.