Anti CAPNS2 pAb (ATL-HPA059749)
Atlas Antibodies
- SKU:
- ATL-HPA059749-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CAPNS2
Alternative Gene Name: MGC12536, MGC14804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078144: 86%, ENSRNOG00000045747: 55%
Entrez Gene ID: 84290
Uniprot ID: Q96L46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD |
Gene Sequence | KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD |
Gene ID - Mouse | ENSMUSG00000078144 |
Gene ID - Rat | ENSRNOG00000045747 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAPNS2 pAb (ATL-HPA059749) | |
Datasheet | Anti CAPNS2 pAb (ATL-HPA059749) Datasheet (External Link) |
Vendor Page | Anti CAPNS2 pAb (ATL-HPA059749) at Atlas Antibodies |
Documents & Links for Anti CAPNS2 pAb (ATL-HPA059749) | |
Datasheet | Anti CAPNS2 pAb (ATL-HPA059749) Datasheet (External Link) |
Vendor Page | Anti CAPNS2 pAb (ATL-HPA059749) |