Anti CAPN9 pAb (ATL-HPA062050)

Atlas Antibodies

Catalog No.:
ATL-HPA062050-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: calpain 9
Gene Name: CAPN9
Alternative Gene Name: GC36, nCL-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031981: 85%, ENSRNOG00000018480: 84%
Entrez Gene ID: 10753
Uniprot ID: O14815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNIN
Gene Sequence GKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNIN
Gene ID - Mouse ENSMUSG00000031981
Gene ID - Rat ENSRNOG00000018480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAPN9 pAb (ATL-HPA062050)
Datasheet Anti CAPN9 pAb (ATL-HPA062050) Datasheet (External Link)
Vendor Page Anti CAPN9 pAb (ATL-HPA062050) at Atlas Antibodies

Documents & Links for Anti CAPN9 pAb (ATL-HPA062050)
Datasheet Anti CAPN9 pAb (ATL-HPA062050) Datasheet (External Link)
Vendor Page Anti CAPN9 pAb (ATL-HPA062050)