Anti CAPN9 pAb (ATL-HPA062050)
Atlas Antibodies
- SKU:
- ATL-HPA062050-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CAPN9
Alternative Gene Name: GC36, nCL-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031981: 85%, ENSRNOG00000018480: 84%
Entrez Gene ID: 10753
Uniprot ID: O14815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNIN |
Gene Sequence | GKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNIN |
Gene ID - Mouse | ENSMUSG00000031981 |
Gene ID - Rat | ENSRNOG00000018480 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAPN9 pAb (ATL-HPA062050) | |
Datasheet | Anti CAPN9 pAb (ATL-HPA062050) Datasheet (External Link) |
Vendor Page | Anti CAPN9 pAb (ATL-HPA062050) at Atlas Antibodies |
Documents & Links for Anti CAPN9 pAb (ATL-HPA062050) | |
Datasheet | Anti CAPN9 pAb (ATL-HPA062050) Datasheet (External Link) |
Vendor Page | Anti CAPN9 pAb (ATL-HPA062050) |