Anti CAPN9 pAb (ATL-HPA020398 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA020398-25
  • Immunohistochemistry analysis in human stomach and pancreas tissues using HPA020398 antibody. Corresponding CAPN9 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calpain 9
Gene Name: CAPN9
Alternative Gene Name: GC36, nCL-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031981: 82%, ENSRNOG00000018480: 80%
Entrez Gene ID: 10753
Uniprot ID: O14815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLS
Gene Sequence PGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLS
Gene ID - Mouse ENSMUSG00000031981
Gene ID - Rat ENSRNOG00000018480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAPN9 pAb (ATL-HPA020398 w/enhanced validation)
Datasheet Anti CAPN9 pAb (ATL-HPA020398 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPN9 pAb (ATL-HPA020398 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAPN9 pAb (ATL-HPA020398 w/enhanced validation)
Datasheet Anti CAPN9 pAb (ATL-HPA020398 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPN9 pAb (ATL-HPA020398 w/enhanced validation)



Citations for Anti CAPN9 pAb (ATL-HPA020398 w/enhanced validation) – 1 Found
Kim, David H; Beckett, James D; Nagpal, Varun; Seman-Senderos, Manuel A; Gould, Russell A; Creamer, Tyler J; MacFarlane, Elena Gallo; Chen, Yichun; Bedja, Djahida; Butcher, Jonathan T; Mitzner, Wayne; Rouf, Rosanne; Hata, Shoji; Warren, Daniel S; Dietz, Harry C. Calpain 9 as a therapeutic target in TGFβ-induced mesenchymal transition and fibrosis. Science Translational Medicine. 2019;11(501)  PubMed