Anti CAPN8 pAb (ATL-HPA073939)

Atlas Antibodies

SKU:
ATL-HPA073939-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear membrane & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calpain 8
Gene Name: CAPN8
Alternative Gene Name: nCL-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038599: 81%, ENSRNOG00000003468: 81%
Entrez Gene ID: 388743
Uniprot ID: A6NHC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDGFNINTCREMISLLDSNGTGTLGAVEFKTLWLKIQKYLEIYWETDYNHSGTIDAHEMRTAL
Gene Sequence FDGFNINTCREMISLLDSNGTGTLGAVEFKTLWLKIQKYLEIYWETDYNHSGTIDAHEMRTAL
Gene ID - Mouse ENSMUSG00000038599
Gene ID - Rat ENSRNOG00000003468
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAPN8 pAb (ATL-HPA073939)
Datasheet Anti CAPN8 pAb (ATL-HPA073939) Datasheet (External Link)
Vendor Page Anti CAPN8 pAb (ATL-HPA073939) at Atlas Antibodies

Documents & Links for Anti CAPN8 pAb (ATL-HPA073939)
Datasheet Anti CAPN8 pAb (ATL-HPA073939) Datasheet (External Link)
Vendor Page Anti CAPN8 pAb (ATL-HPA073939)