Anti CAPN2 pAb (ATL-HPA024470 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024470-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: calpain 2, (m/II) large subunit
Gene Name: CAPN2
Alternative Gene Name: CANPL2, CANPml, mCANP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026509: 93%, ENSRNOG00000034015: 91%
Entrez Gene ID: 824
Uniprot ID: P17655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVD
Gene Sequence ANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVD
Gene ID - Mouse ENSMUSG00000026509
Gene ID - Rat ENSRNOG00000034015
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAPN2 pAb (ATL-HPA024470 w/enhanced validation)
Datasheet Anti CAPN2 pAb (ATL-HPA024470 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPN2 pAb (ATL-HPA024470 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAPN2 pAb (ATL-HPA024470 w/enhanced validation)
Datasheet Anti CAPN2 pAb (ATL-HPA024470 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPN2 pAb (ATL-HPA024470 w/enhanced validation)
Citations for Anti CAPN2 pAb (ATL-HPA024470 w/enhanced validation) – 2 Found
Peng, Xiulan; Yang, Rui; Song, Jia; Wang, Xia; Dong, Weiguo. Calpain2 Upregulation Regulates EMT-Mediated Pancreatic Cancer Metastasis via the Wnt/β-Catenin Signaling Pathway. Frontiers In Medicine. 9( 35707527):783592.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed