Anti CAPN15 pAb (ATL-HPA011960)

Atlas Antibodies

SKU:
ATL-HPA011960-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calpain 15
Gene Name: CAPN15
Alternative Gene Name: SOLH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037326: 75%, ENSRNOG00000020239: 76%
Entrez Gene ID: 6650
Uniprot ID: O75808
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLPVLNGVLPKPPAILGEPKGSCQEEAGPVRTAGLVATEPARGQCEDKDEEEKEEQEEEEGAAEPRGGWACPRCTLHNTPVASSCSVCGGPRRLSLPRIPPEALVVPE
Gene Sequence FLPVLNGVLPKPPAILGEPKGSCQEEAGPVRTAGLVATEPARGQCEDKDEEEKEEQEEEEGAAEPRGGWACPRCTLHNTPVASSCSVCGGPRRLSLPRIPPEALVVPE
Gene ID - Mouse ENSMUSG00000037326
Gene ID - Rat ENSRNOG00000020239
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAPN15 pAb (ATL-HPA011960)
Datasheet Anti CAPN15 pAb (ATL-HPA011960) Datasheet (External Link)
Vendor Page Anti CAPN15 pAb (ATL-HPA011960) at Atlas Antibodies

Documents & Links for Anti CAPN15 pAb (ATL-HPA011960)
Datasheet Anti CAPN15 pAb (ATL-HPA011960) Datasheet (External Link)
Vendor Page Anti CAPN15 pAb (ATL-HPA011960)