Anti CAPN11 pAb (ATL-HPA030955 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030955-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: calpain 11
Gene Name: CAPN11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058626: 59%, ENSRNOG00000026025: 58%
Entrez Gene ID: 11131
Uniprot ID: Q9UMQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGK
Gene Sequence WELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGK
Gene ID - Mouse ENSMUSG00000058626
Gene ID - Rat ENSRNOG00000026025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAPN11 pAb (ATL-HPA030955 w/enhanced validation)
Datasheet Anti CAPN11 pAb (ATL-HPA030955 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPN11 pAb (ATL-HPA030955 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAPN11 pAb (ATL-HPA030955 w/enhanced validation)
Datasheet Anti CAPN11 pAb (ATL-HPA030955 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPN11 pAb (ATL-HPA030955 w/enhanced validation)