Anti CAPG pAb (ATL-HPA019092 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019092-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: capping protein (actin filament), gelsolin-like
Gene Name: CAPG
Alternative Gene Name: AFCP, MCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056737: 95%, ENSRNOG00000013668: 95%
Entrez Gene ID: 822
Uniprot ID: P40121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVAD
Gene Sequence ERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVAD
Gene ID - Mouse ENSMUSG00000056737
Gene ID - Rat ENSRNOG00000013668
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAPG pAb (ATL-HPA019092 w/enhanced validation)
Datasheet Anti CAPG pAb (ATL-HPA019092 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPG pAb (ATL-HPA019092 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAPG pAb (ATL-HPA019092 w/enhanced validation)
Datasheet Anti CAPG pAb (ATL-HPA019092 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAPG pAb (ATL-HPA019092 w/enhanced validation)
Citations for Anti CAPG pAb (ATL-HPA019092 w/enhanced validation) – 2 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed