Anti CAPG pAb (ATL-HPA019080 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019080-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CAPG
Alternative Gene Name: AFCP, MCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056737: 92%, ENSRNOG00000013668: 93%
Entrez Gene ID: 822
Uniprot ID: P40121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLF |
Gene Sequence | PFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLF |
Gene ID - Mouse | ENSMUSG00000056737 |
Gene ID - Rat | ENSRNOG00000013668 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAPG pAb (ATL-HPA019080 w/enhanced validation) | |
Datasheet | Anti CAPG pAb (ATL-HPA019080 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAPG pAb (ATL-HPA019080 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CAPG pAb (ATL-HPA019080 w/enhanced validation) | |
Datasheet | Anti CAPG pAb (ATL-HPA019080 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAPG pAb (ATL-HPA019080 w/enhanced validation) |
Citations for Anti CAPG pAb (ATL-HPA019080 w/enhanced validation) – 4 Found |
Zhaojie, Lyu; Yuchen, Liu; Miao, Chen; Yacun, Chen; Shayi, Wu; Anbang, He; Xinhui, Liao; Meng, Zhang; Peipei, Wu; Hongbing, Mei; Feng, Wang; Zhiming, Cai; Xinyuan, Guan. Gelsolin-like actin-capping protein has prognostic value and promotes tumorigenesis and epithelial-mesenchymal transition via the Hippo signaling pathway in human bladder cancer. Therapeutic Advances In Medical Oncology. 11( 31068979):1758835919841235. PubMed |
Westbrook, Jules A; Cairns, David A; Peng, Jianhe; Speirs, Valerie; Hanby, Andrew M; Holen, Ingunn; Wood, Steven L; Ottewell, Penelope D; Marshall, Helen; Banks, Rosamonde E; Selby, Peter J; Coleman, Robert E; Brown, Janet E. CAPG and GIPC1: Breast Cancer Biomarkers for Bone Metastasis Development and Treatment. Journal Of The National Cancer Institute. 2016;108(4) PubMed |
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
Zhou, Qingjiu; Shaya, Mahati; Kugeluke, Yalikun; Fu, Qiang; Li, Shaoshan; Dilimulati, Yisireyili. A circular RNA derived from GLIS3 accelerates the proliferation of glioblastoma cells through competitively binding with miR-449c-5p to upregulate CAPG and GLIS3. Bmc Neuroscience. 2022;23(1):53. PubMed |