Anti CAP1 pAb (ATL-HPA030124)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030124-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: CAP1
Alternative Gene Name: CAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028656: 96%, ENSRNOG00000013492: 96%
Entrez Gene ID: 10487
Uniprot ID: Q01518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE |
| Gene Sequence | VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE |
| Gene ID - Mouse | ENSMUSG00000028656 |
| Gene ID - Rat | ENSRNOG00000013492 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAP1 pAb (ATL-HPA030124) | |
| Datasheet | Anti CAP1 pAb (ATL-HPA030124) Datasheet (External Link) |
| Vendor Page | Anti CAP1 pAb (ATL-HPA030124) at Atlas Antibodies |
| Documents & Links for Anti CAP1 pAb (ATL-HPA030124) | |
| Datasheet | Anti CAP1 pAb (ATL-HPA030124) Datasheet (External Link) |
| Vendor Page | Anti CAP1 pAb (ATL-HPA030124) |
| Citations for Anti CAP1 pAb (ATL-HPA030124) – 2 Found |
| Rosendahl, Ann H; Bergqvist, Malin; Lettiero, Barbara; Kimbung, Siker; Borgquist, Signe. Adipocytes and Obesity-Related Conditions Jointly Promote Breast Cancer Cell Growth and Motility: Associations With CAP1 for Prognosis. Frontiers In Endocrinology. 9( 30524378):689. PubMed |
| Bergqvist, Malin; Elebro, Karin; Sandsveden, Malte; Borgquist, Signe; Rosendahl, Ann H. Effects of tumor-specific CAP1 expression and body constitution on clinical outcomes in patients with early breast cancer. Breast Cancer Research : Bcr. 2020;22(1):67. PubMed |