Anti CAP1 pAb (ATL-HPA030124)

Atlas Antibodies

Catalog No.: ATL-HPA030124-100

Protein Description: CAP, adenylate cyclase-associated protein 1 (yeast)
Gene Name: CAP1
Alternative Gene Name: CAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028656: 96%, ENSRNOG00000013492: 96%
Entrez Gene ID: 10487
Uniprot ID: Q01518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE
• Gene Sequence: VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE
• Gene ID - Mouse: ENSMUSG00000028656
• Gene ID - Rat: ENSRNOG00000013492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CAP1 pAb (ATL-HPA030124) – 2 Found

Rosendahl, Ann H; Bergqvist, Malin; Lettiero, Barbara; Kimbung, Siker; Borgquist, Signe. Adipocytes and Obesity-Related Conditions Jointly Promote Breast Cancer Cell Growth and Motility: Associations With CAP1 for Prognosis. Frontiers In Endocrinology. 9( 30524378):689. 

Bergqvist, Malin; Elebro, Karin; Sandsveden, Malte; Borgquist, Signe; Rosendahl, Ann H. Effects of tumor-specific CAP1 expression and body constitution on clinical outcomes in patients with early breast cancer. Breast Cancer Research : Bcr. 2020;22(1):67.