Anti CANX pAb (ATL-HPA009433 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA009433-25

• 
• 

Protein Description: calnexin
Gene Name: CANX
Alternative Gene Name: CNX, IP90, P90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020368: 88%, ENSRNOG00000003343: 89%
Entrez Gene ID: 821
Uniprot ID: P27824
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI
• Gene Sequence: DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI
• Gene ID - Mouse: ENSMUSG00000020368
• Gene ID - Rat: ENSRNOG00000003343
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CANX pAb (ATL-HPA009433 w/enhanced validation) – 2 Found

Nordholm, Johan; Petitou, Jeanne; Östbye, Henrik; da Silva, Diogo V; Dou, Dan; Wang, Hao; Daniels, Robert. Translational regulation of viral secretory proteins by the 5' coding regions and a viral RNA-binding protein. The Journal Of Cell Biology. 2017;216(8):2283-2293. 

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.