Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019639-25

Protein Description: calcium activated nucleotidase 1
Gene Name: CANT1
Alternative Gene Name: SCAN-1, SHAPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025575: 96%, ENSRNOG00000003239: 94%
Entrez Gene ID: 124583
Uniprot ID: Q8WVQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK
• Gene Sequence: QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK
• Gene ID - Mouse: ENSMUSG00000025575
• Gene ID - Rat: ENSRNOG00000003239
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) – 3 Found

Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22. 

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. 

Wang, Jiachen; Wang, Zhao; Yuan, Jiaxiang; Wang, Jiaxiang; Shen, Xinsheng. The positive feedback between ACSL4 expression and O-GlcNAcylation contributes to the growth and survival of hepatocellular carcinoma. Aging. 2020;12(9):7786-7800.