Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019639-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CANT1
Alternative Gene Name: SCAN-1, SHAPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025575: 96%, ENSRNOG00000003239: 94%
Entrez Gene ID: 124583
Uniprot ID: Q8WVQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK |
Gene Sequence | QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK |
Gene ID - Mouse | ENSMUSG00000025575 |
Gene ID - Rat | ENSRNOG00000003239 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) | |
Datasheet | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) | |
Datasheet | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) |
Citations for Anti CANT1 pAb (ATL-HPA019639 w/enhanced validation) – 3 Found |
Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22. PubMed |
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
Wang, Jiachen; Wang, Zhao; Yuan, Jiaxiang; Wang, Jiaxiang; Shen, Xinsheng. The positive feedback between ACSL4 expression and O-GlcNAcylation contributes to the growth and survival of hepatocellular carcinoma. Aging. 2020;12(9):7786-7800. PubMed |