Anti CAND1 pAb (ATL-HPA062833 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA062833-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic and nuclear positivity in renal tubules.
  • Western blot analysis using Anti-CAND1 antibody HPA062833 (A) shows similar pattern to independent antibody HPA055748 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cullin-associated and neddylation-dissociated 1
Gene Name: CAND1
Alternative Gene Name: DKFZp434M1414, KIAA0829, TIP120, TIP120A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020114: 98%, ENSRNOG00000007834: 100%
Entrez Gene ID: 55832
Uniprot ID: Q86VP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG
Gene Sequence QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG
Gene ID - Mouse ENSMUSG00000020114
Gene ID - Rat ENSRNOG00000007834
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAND1 pAb (ATL-HPA062833 w/enhanced validation)
Datasheet Anti CAND1 pAb (ATL-HPA062833 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAND1 pAb (ATL-HPA062833 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAND1 pAb (ATL-HPA062833 w/enhanced validation)
Datasheet Anti CAND1 pAb (ATL-HPA062833 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAND1 pAb (ATL-HPA062833 w/enhanced validation)