Anti CAMTA2 pAb (ATL-HPA051147)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051147-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CAMTA2
Alternative Gene Name: KIAA0909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040712: 90%, ENSRNOG00000004283: 90%
Entrez Gene ID: 23125
Uniprot ID: O94983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EKRMAEIAAAGQVPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWKGPERLAHGS |
Gene Sequence | EKRMAEIAAAGQVPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWKGPERLAHGS |
Gene ID - Mouse | ENSMUSG00000040712 |
Gene ID - Rat | ENSRNOG00000004283 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAMTA2 pAb (ATL-HPA051147) | |
Datasheet | Anti CAMTA2 pAb (ATL-HPA051147) Datasheet (External Link) |
Vendor Page | Anti CAMTA2 pAb (ATL-HPA051147) at Atlas Antibodies |
Documents & Links for Anti CAMTA2 pAb (ATL-HPA051147) | |
Datasheet | Anti CAMTA2 pAb (ATL-HPA051147) Datasheet (External Link) |
Vendor Page | Anti CAMTA2 pAb (ATL-HPA051147) |