Anti CAMTA2 pAb (ATL-HPA027835)

Atlas Antibodies

SKU:
ATL-HPA027835-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calmodulin binding transcription activator 2
Gene Name: CAMTA2
Alternative Gene Name: KIAA0909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040712: 85%, ENSRNOG00000004283: 87%
Entrez Gene ID: 23125
Uniprot ID: O94983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEF
Gene Sequence LPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEF
Gene ID - Mouse ENSMUSG00000040712
Gene ID - Rat ENSRNOG00000004283
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAMTA2 pAb (ATL-HPA027835)
Datasheet Anti CAMTA2 pAb (ATL-HPA027835) Datasheet (External Link)
Vendor Page Anti CAMTA2 pAb (ATL-HPA027835) at Atlas Antibodies

Documents & Links for Anti CAMTA2 pAb (ATL-HPA027835)
Datasheet Anti CAMTA2 pAb (ATL-HPA027835) Datasheet (External Link)
Vendor Page Anti CAMTA2 pAb (ATL-HPA027835)