Anti CAMTA1 pAb (ATL-HPA036343)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036343-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CAMTA1
Alternative Gene Name: KIAA0833
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014592: 92%, ENSRNOG00000018602: 92%
Entrez Gene ID: 23261
Uniprot ID: Q9Y6Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFLNNPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTE |
| Gene Sequence | ESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFLNNPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTE |
| Gene ID - Mouse | ENSMUSG00000014592 |
| Gene ID - Rat | ENSRNOG00000018602 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAMTA1 pAb (ATL-HPA036343) | |
| Datasheet | Anti CAMTA1 pAb (ATL-HPA036343) Datasheet (External Link) |
| Vendor Page | Anti CAMTA1 pAb (ATL-HPA036343) at Atlas Antibodies |
| Documents & Links for Anti CAMTA1 pAb (ATL-HPA036343) | |
| Datasheet | Anti CAMTA1 pAb (ATL-HPA036343) Datasheet (External Link) |
| Vendor Page | Anti CAMTA1 pAb (ATL-HPA036343) |
| Citations for Anti CAMTA1 pAb (ATL-HPA036343) – 2 Found |
| Bas-Orth, Carlos; Tan, Yan-Wei; Oliveira, Ana M M; Bengtson, C Peter; Bading, Hilmar. The calmodulin-binding transcription activator CAMTA1 is required for long-term memory formation in mice. Learning & Memory (Cold Spring Harbor, N.y.). 2016;23(6):313-21. PubMed |
| Neelagandan, Nagammal; Gonnella, Giorgio; Dang, Stefan; Janiesch, Philipp C; Miller, Katharine K; Küchler, Katrin; Marques, Rita F; Indenbirken, Daniela; Alawi, Malik; Grundhoff, Adam; Kurtz, Stefan; Duncan, Kent E. TDP-43 enhances translation of specific mRNAs linked to neurodegenerative disease. Nucleic Acids Research. 2019;47(1):341-361. PubMed |