Anti CAMTA1 pAb (ATL-HPA036343)

Atlas Antibodies

Catalog No.:
ATL-HPA036343-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: calmodulin binding transcription activator 1
Gene Name: CAMTA1
Alternative Gene Name: KIAA0833
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014592: 92%, ENSRNOG00000018602: 92%
Entrez Gene ID: 23261
Uniprot ID: Q9Y6Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFLNNPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTE
Gene Sequence ESLSMLPTNVSEELVLSTTLDGGRKIPETTMNFDPDCFLNNPKQGQTYGGGGLKAEMVSSNIRHSPPGERSFSFTTVLTKEIKTE
Gene ID - Mouse ENSMUSG00000014592
Gene ID - Rat ENSRNOG00000018602
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMTA1 pAb (ATL-HPA036343)
Datasheet Anti CAMTA1 pAb (ATL-HPA036343) Datasheet (External Link)
Vendor Page Anti CAMTA1 pAb (ATL-HPA036343) at Atlas Antibodies

Documents & Links for Anti CAMTA1 pAb (ATL-HPA036343)
Datasheet Anti CAMTA1 pAb (ATL-HPA036343) Datasheet (External Link)
Vendor Page Anti CAMTA1 pAb (ATL-HPA036343)
Citations for Anti CAMTA1 pAb (ATL-HPA036343) – 2 Found
Bas-Orth, Carlos; Tan, Yan-Wei; Oliveira, Ana M M; Bengtson, C Peter; Bading, Hilmar. The calmodulin-binding transcription activator CAMTA1 is required for long-term memory formation in mice. Learning & Memory (Cold Spring Harbor, N.y.). 2016;23(6):313-21.  PubMed
Neelagandan, Nagammal; Gonnella, Giorgio; Dang, Stefan; Janiesch, Philipp C; Miller, Katharine K; Küchler, Katrin; Marques, Rita F; Indenbirken, Daniela; Alawi, Malik; Grundhoff, Adam; Kurtz, Stefan; Duncan, Kent E. TDP-43 enhances translation of specific mRNAs linked to neurodegenerative disease. Nucleic Acids Research. 2019;47(1):341-361.  PubMed