Anti CAMSAP2 pAb (ATL-HPA027302 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027302-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: calmodulin regulated spectrin-associated protein family, member 2
Gene Name: CAMSAP2
Alternative Gene Name: CAMSAP1L1, KIAA1078
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041570: 95%, ENSRNOG00000008741: 98%
Entrez Gene ID: 23271
Uniprot ID: Q08AD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLVTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDAVMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGG
Gene Sequence KLVTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDAVMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGG
Gene ID - Mouse ENSMUSG00000041570
Gene ID - Rat ENSRNOG00000008741
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMSAP2 pAb (ATL-HPA027302 w/enhanced validation)
Datasheet Anti CAMSAP2 pAb (ATL-HPA027302 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAMSAP2 pAb (ATL-HPA027302 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAMSAP2 pAb (ATL-HPA027302 w/enhanced validation)
Datasheet Anti CAMSAP2 pAb (ATL-HPA027302 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAMSAP2 pAb (ATL-HPA027302 w/enhanced validation)