Anti CAMSAP2 pAb (ATL-HPA026304 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026304-25
  • Immunohistochemical staining of human cerebral cortex, placenta, prostate and testis using Anti-CAMSAP2 antibody HPA026304 (A) shows similar protein distribution across tissues to independent antibody HPA026511 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calmodulin regulated spectrin-associated protein family, member 2
Gene Name: CAMSAP2
Alternative Gene Name: CAMSAP1L1, KIAA1078
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041570: 81%, ENSRNOG00000008741: 77%
Entrez Gene ID: 23271
Uniprot ID: Q08AD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPL
Gene Sequence SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPL
Gene ID - Mouse ENSMUSG00000041570
Gene ID - Rat ENSRNOG00000008741
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CAMSAP2 pAb (ATL-HPA026304 w/enhanced validation)
Datasheet Anti CAMSAP2 pAb (ATL-HPA026304 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAMSAP2 pAb (ATL-HPA026304 w/enhanced validation)