Anti CAMSAP1 pAb (ATL-HPA024161)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024161-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CAMSAP1
Alternative Gene Name: DKFZp434F195, FLJ31228
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026933: 66%, ENSRNOG00000017883: 65%
Entrez Gene ID: 157922
Uniprot ID: Q5T5Y3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILSEQMSLKEVLDASVKEVGSSSSDVSGKESVPVEEPLRSRASLIEVDLSDLK |
| Gene Sequence | TPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILSEQMSLKEVLDASVKEVGSSSSDVSGKESVPVEEPLRSRASLIEVDLSDLK |
| Gene ID - Mouse | ENSMUSG00000026933 |
| Gene ID - Rat | ENSRNOG00000017883 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAMSAP1 pAb (ATL-HPA024161) | |
| Datasheet | Anti CAMSAP1 pAb (ATL-HPA024161) Datasheet (External Link) |
| Vendor Page | Anti CAMSAP1 pAb (ATL-HPA024161) at Atlas Antibodies |
| Documents & Links for Anti CAMSAP1 pAb (ATL-HPA024161) | |
| Datasheet | Anti CAMSAP1 pAb (ATL-HPA024161) Datasheet (External Link) |
| Vendor Page | Anti CAMSAP1 pAb (ATL-HPA024161) |