Anti CAMSAP1 pAb (ATL-HPA024161)

Atlas Antibodies

SKU: ATL-HPA024161-25

• 

Protein Description: calmodulin regulated spectrin-associated protein 1
Gene Name: CAMSAP1
Alternative Gene Name: DKFZp434F195, FLJ31228
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026933: 66%, ENSRNOG00000017883: 65%
Entrez Gene ID: 157922
Uniprot ID: Q5T5Y3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILSEQMSLKEVLDASVKEVGSSSSDVSGKESVPVEEPLRSRASLIEVDLSDLK
• Gene Sequence: TPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILSEQMSLKEVLDASVKEVGSSSSDVSGKESVPVEEPLRSRASLIEVDLSDLK
• Gene ID - Mouse: ENSMUSG00000026933
• Gene ID - Rat: ENSRNOG00000017883
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.