Anti CAMP pAb (ATL-HPA029874 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029874-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CAMP
Alternative Gene Name: CAP18, FALL-39, FALL39, LL37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038357: 54%, ENSRNOG00000020733: 55%
Entrez Gene ID: 820
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR |
Gene Sequence | RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR |
Gene ID - Mouse | ENSMUSG00000038357 |
Gene ID - Rat | ENSRNOG00000020733 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) | |
Datasheet | Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) | |
Datasheet | Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) |
Citations for Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) – 2 Found |
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
Deng, Zhili; Chen, Mengting; Liu, Yingzi; Xu, San; Ouyang, Yuyan; Shi, Wei; Jian, Dan; Wang, Ben; Liu, Fangfen; Li, Jinmao; Shi, Qian; Peng, Qinqin; Sha, Ke; Xiao, Wenqin; Liu, Tangxiele; Zhang, Yiya; Zhang, Hongbing; Wang, Qian; Sun, Lunquan; Xie, Hongfu; Li, Ji. A positive feedback loop between mTORC1 and cathelicidin promotes skin inflammation in rosacea. Embo Molecular Medicine. 2021;13(5):e13560. PubMed |