Anti CAMP pAb (ATL-HPA029874 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029874-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cathelicidin antimicrobial peptide
Gene Name: CAMP
Alternative Gene Name: CAP18, FALL-39, FALL39, LL37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038357: 54%, ENSRNOG00000020733: 55%
Entrez Gene ID: 820
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
Gene Sequence RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR
Gene ID - Mouse ENSMUSG00000038357
Gene ID - Rat ENSRNOG00000020733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMP pAb (ATL-HPA029874 w/enhanced validation)
Datasheet Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CAMP pAb (ATL-HPA029874 w/enhanced validation)
Datasheet Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAMP pAb (ATL-HPA029874 w/enhanced validation)
Citations for Anti CAMP pAb (ATL-HPA029874 w/enhanced validation) – 2 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Deng, Zhili; Chen, Mengting; Liu, Yingzi; Xu, San; Ouyang, Yuyan; Shi, Wei; Jian, Dan; Wang, Ben; Liu, Fangfen; Li, Jinmao; Shi, Qian; Peng, Qinqin; Sha, Ke; Xiao, Wenqin; Liu, Tangxiele; Zhang, Yiya; Zhang, Hongbing; Wang, Qian; Sun, Lunquan; Xie, Hongfu; Li, Ji. A positive feedback loop between mTORC1 and cathelicidin promotes skin inflammation in rosacea. Embo Molecular Medicine. 2021;13(5):e13560.  PubMed