Anti CAMLG pAb (ATL-HPA056472)

Atlas Antibodies

Catalog No.:
ATL-HPA056472-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: calcium modulating ligand
Gene Name: CAMLG
Alternative Gene Name: CAML
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021501: 84%, ENSRNOG00000021911: 84%
Entrez Gene ID: 819
Uniprot ID: P49069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQT
Gene Sequence MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQT
Gene ID - Mouse ENSMUSG00000021501
Gene ID - Rat ENSRNOG00000021911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMLG pAb (ATL-HPA056472)
Datasheet Anti CAMLG pAb (ATL-HPA056472) Datasheet (External Link)
Vendor Page Anti CAMLG pAb (ATL-HPA056472) at Atlas Antibodies

Documents & Links for Anti CAMLG pAb (ATL-HPA056472)
Datasheet Anti CAMLG pAb (ATL-HPA056472) Datasheet (External Link)
Vendor Page Anti CAMLG pAb (ATL-HPA056472)