Anti CAMKV pAb (ATL-HPA007656 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007656-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CAMKV
Alternative Gene Name: MGC8407, VACAMKL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032936: 100%, ENSRNOG00000058938: 100%
Entrez Gene ID: 79012
Uniprot ID: Q8NCB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGVCAQIEKNFARAKW |
| Gene Sequence | LLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGVCAQIEKNFARAKW |
| Gene ID - Mouse | ENSMUSG00000032936 |
| Gene ID - Rat | ENSRNOG00000058938 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAMKV pAb (ATL-HPA007656 w/enhanced validation) | |
| Datasheet | Anti CAMKV pAb (ATL-HPA007656 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAMKV pAb (ATL-HPA007656 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CAMKV pAb (ATL-HPA007656 w/enhanced validation) | |
| Datasheet | Anti CAMKV pAb (ATL-HPA007656 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CAMKV pAb (ATL-HPA007656 w/enhanced validation) |
| Citations for Anti CAMKV pAb (ATL-HPA007656 w/enhanced validation) – 2 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |