Anti CAMKK2 pAb (ATL-HPA063713)

Atlas Antibodies

Catalog No.:
ATL-HPA063713-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: calcium/calmodulin dependent protein kinase kinase 2
Gene Name: CAMKK2
Alternative Gene Name: CAMKK, CAMKKB, KIAA0787, MGC15254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029471: 100%, ENSRNOG00000001309: 100%
Entrez Gene ID: 10645
Uniprot ID: Q96RR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES
Gene Sequence FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES
Gene ID - Mouse ENSMUSG00000029471
Gene ID - Rat ENSRNOG00000001309
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMKK2 pAb (ATL-HPA063713)
Datasheet Anti CAMKK2 pAb (ATL-HPA063713) Datasheet (External Link)
Vendor Page Anti CAMKK2 pAb (ATL-HPA063713) at Atlas Antibodies

Documents & Links for Anti CAMKK2 pAb (ATL-HPA063713)
Datasheet Anti CAMKK2 pAb (ATL-HPA063713) Datasheet (External Link)
Vendor Page Anti CAMKK2 pAb (ATL-HPA063713)