Anti CAMKK2 pAb (ATL-HPA063713)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063713-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CAMKK2
Alternative Gene Name: CAMKK, CAMKKB, KIAA0787, MGC15254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029471: 100%, ENSRNOG00000001309: 100%
Entrez Gene ID: 10645
Uniprot ID: Q96RR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES |
| Gene Sequence | FVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPES |
| Gene ID - Mouse | ENSMUSG00000029471 |
| Gene ID - Rat | ENSRNOG00000001309 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CAMKK2 pAb (ATL-HPA063713) | |
| Datasheet | Anti CAMKK2 pAb (ATL-HPA063713) Datasheet (External Link) |
| Vendor Page | Anti CAMKK2 pAb (ATL-HPA063713) at Atlas Antibodies |
| Documents & Links for Anti CAMKK2 pAb (ATL-HPA063713) | |
| Datasheet | Anti CAMKK2 pAb (ATL-HPA063713) Datasheet (External Link) |
| Vendor Page | Anti CAMKK2 pAb (ATL-HPA063713) |